SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021010 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021010
Domain Number 1 Region: 59-197
Classification Level Classification E-value
Superfamily L domain-like 4.71e-34
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021010
Domain Number - Region: 337-447
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.0785
Family Fucose-specific lectin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021010   Gene: ENSGGOG00000024078   Transcript: ENSGGOT00000027587
Sequence length 545
Comment pep:novel chromosome:gorGor3.1:19:32391043:32401611:-1 gene:ENSGGOG00000024078 transcript:ENSGGOT00000027587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPQSGGGGMGGAGILLLLLAGAGVVVAWRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSP
TLLSLSLVRTGVTQLKAGSFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEI
GSISKNALRGLRSLTHLSLANNHLETLPRFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQW
MPTVNASVGTGACAGPAALSHVQLHHLDPKTFKCRAIELSWFQTVGESALSVEPFSYQGE
PHIVLAQPFAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSLFVLAARLWGGSQ
LWARPSPGLRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGPGF
YPHQSLHAWHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYAT
RHFQAGGDVFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSD
FAFSQVLRLEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHE
IDLSA
Download sequence
Identical sequences ENSGGOP00000021010 ENSGGOP00000021010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]