SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021545 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021545
Domain Number 1 Region: 215-264
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000632
Family LIM domain 0.0018
Further Details:      
 
Domain Number 2 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000123
Family LIM domain 0.00091
Further Details:      
 
Domain Number 3 Region: 261-302
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000253
Family LIM domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021545
Domain Number - Region: 99-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0369
Family LIM domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021545   Gene: ENSGGOG00000022446   Transcript: ENSGGOT00000026536
Sequence length 304
Comment pep:novel chromosome:gorGor3.1:2a:108199300:108222531:-1 gene:ENSGGOG00000022446 transcript:ENSGGOT00000026536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGRARPCVIPENEEIPRAALNSVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFHDERL
KCQMHARYLIAVSCEATGAESEGKAQNSLEQRRIKCDSSRPAHPSHWTINTLPGSVCCYS
KRKTNGLKCNVIMDCHSNIFKNLLKNRKELTADARELKGELYCLPCHDKMGVPICGACRR
PIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRV
IEGD
Download sequence
Identical sequences ENSGGOP00000021545 ENSGGOP00000021545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]