SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022526 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022526
Domain Number 1 Region: 31-330
Classification Level Classification E-value
Superfamily L domain-like 1.63e-47
Family Ngr ectodomain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022526   Gene: ENSGGOG00000028361   Transcript: ENSGGOT00000023143
Sequence length 338
Comment pep:novel chromosome:gorGor3.1:12:90027108:90035409:-1 gene:ENSGGOG00000028361 transcript:ENSGGOT00000023143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIAKLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDVKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Download sequence
Identical sequences H2Q6L3
ENSGGOP00000022526 ENSGGOP00000022526 ENSPTRP00000008987 ENSPTRP00000008987 9598.ENSPTRP00000008987 XP_003823450.1.60992 XP_509260.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]