SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022532 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022532
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000906
Family RING finger domain, C3HC4 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022532   Gene: ENSGGOG00000024306   Transcript: ENSGGOT00000031581
Sequence length 102
Comment pep:novel chromosome:gorGor3.1:5:26900350:26901784:-1 gene:ENSGGOG00000024306 transcript:ENSGGOT00000031581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KIQSLPTVPVTEEHVGSGLECPVCKDDYALGEQLPRNHLFHDGCIVHRLEQHDSCPVCRK
SLPGHNTATNTPAPGPTGMNCSSSSSSPSSSSPSKENATSNS
Download sequence
Identical sequences ENSGGOP00000022532 ENSGGOP00000022532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]