SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022643 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022643
Domain Number 1 Region: 5-205
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.85e-43
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 320-447
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 6.28e-32
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 214-314
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.21e-25
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022643   Gene: ENSGGOG00000025911   Transcript: ENSGGOT00000026090
Sequence length 495
Comment pep:novel chromosome:gorGor3.1:4:39801146:39824726:-1 gene:ENSGGOG00000025911 transcript:ENSGGOT00000026090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEV
VESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNS
NGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLI
GGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISAL
CEATGADVEEVATAIGMDQRIGNKFLKASVAGFGGSCFQKDVLNLVYLCEALNLPEVARY
WQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMD
EGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDM
FKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYASSGEI
PKFSLQDPPNKKPKV
Download sequence
Identical sequences ENSGGOP00000022643 ENSGGOP00000022643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]