SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023900 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023900
Domain Number - Region: 67-136
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00719
Family C-terminal domain of PLC-beta 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023900   Gene: ENSGGOG00000022100   Transcript: ENSGGOT00000034470
Sequence length 154
Comment pep:novel chromosome:gorGor3.1:17:56824537:56825013:-1 gene:ENSGGOG00000022100 transcript:ENSGGOT00000034470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAQIFANTVDNACIVLRIDNAYLAADVFRVKYETELAMCQSIENDIHGLCKVIDDTNLET
DIEALREELLLMKENHEEEVKGLQAQLASSRLTVKVDAPKSQDLAKIMADIQAQYDKLAQ
KNQEELDKYWSQQIEESTTVVTTQSAQVGAAEMT
Download sequence
Identical sequences ENSGGOP00000023900 ENSGGOP00000023900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]