SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023981 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023981
Domain Number 1 Region: 73-436
Classification Level Classification E-value
Superfamily Serpins 2.36e-97
Family Serpins 0.00000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023981   Gene: ENSGGOG00000026220   Transcript: ENSGGOT00000034363
Sequence length 491
Comment pep:novel chromosome:gorGor3.1:17:1683607:1700872:1 gene:ENSGGOG00000026220 transcript:ENSGGOT00000034363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVPPLTLLKLGNQEPGGQ
TALKSPPGICSRDPTPEQTRRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHL
ALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLE
QSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGF
WRNKFDPSLTQRESFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELF
QAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPM
EEDYPQFGSPK
Download sequence
Identical sequences G3S7C3
ENSGGOP00000023981 XP_004058283.1.27298 ENSGGOP00000023981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]