SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024258 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024258
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.36e-38
Family MHC antigen-recognition domain 0.0000153
Further Details:      
 
Domain Number 2 Region: 119-216
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-29
Family C1 set domains (antibody constant domain-like) 0.00000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024258   Gene: ENSGGOG00000014413   Transcript: ENSGGOT00000026929
Sequence length 264
Comment pep:novel chromosome:gorGor3.1:6:33717086:33724463:-1 gene:ENSGGOG00000014413 transcript:ENSGGOT00000026929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIY
NREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQR
QVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDW
TFQILVMLEITPQRGDIYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVLGLIFL
GLGLIIRHRGQKGPRGPPPAGLLH
Download sequence
Identical sequences G3SJ91
ENSGGOP00000028181 ENSGGOP00000024258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]