SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024313 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024313
Domain Number 1 Region: 264-364
Classification Level Classification E-value
Superfamily EF-hand 3.33e-25
Family Eps15 homology domain (EH domain) 0.0000799
Further Details:      
 
Domain Number 2 Region: 117-214
Classification Level Classification E-value
Superfamily EF-hand 2.47e-17
Family Eps15 homology domain (EH domain) 0.0000943
Further Details:      
 
Domain Number 3 Region: 16-105
Classification Level Classification E-value
Superfamily EF-hand 4.99e-17
Family Eps15 homology domain (EH domain) 0.0000949
Further Details:      
 
Domain Number 4 Region: 386-499
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000863
Family Myosin rod fragments 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024313   Gene: ENSGGOG00000013623   Transcript: ENSGGOT00000025891
Sequence length 910
Comment pep:novel chromosome:gorGor3.1:19:16676604:16765164:-1 gene:ENSGGOG00000013623 transcript:ENSGGOT00000025891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAGQCTSLSTEIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAH
WAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRRWSLGERDSGGSLG
ITEHLQAMHLVYRALEKEPVPSALPPSLIPPSKRKKTVFPGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEI
NQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAMDDP
FKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFKGDPFQNDPFAEQQTTSTDPFGG
DPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSVSSKG
SDPFGTLDPFGSGSFSSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPFKSKQDTPALP
PKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDP
FVPSSAAKPSKASASGFADFTSFGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAI
ALSKADMPAA
Download sequence
Identical sequences ENSGGOP00000024313 ENSGGOP00000024313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]