SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024407 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024407
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily EF-hand 0.0000000257
Family S100 proteins 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024407   Gene: ENSGGOG00000027399   Transcript: ENSGGOT00000034073
Sequence length 94
Comment pep:novel chromosome:gorGor3.1:21:35372173:35375121:-1 gene:ENSGGOG00000027399 transcript:ENSGGOT00000034073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLERWSLPMLPRLVSNF
LCSSYPPALASQSAGITGNQRARGCGQSHGNTGQ
Download sequence
Identical sequences G3S8J4
ENSGGOP00000024407 ENSGGOP00000024407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]