SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024506 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024506
Domain Number 1 Region: 341-577
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 9.55e-81
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0000000162
Further Details:      
 
Domain Number 2 Region: 7-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.61e-70
Family G proteins 0.00000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024506   Gene: ENSGGOG00000001719   Transcript: ENSGGOT00000033189
Sequence length 586
Comment pep:novel chromosome:gorGor3.1:1:91529155:91544413:-1 gene:ENSGGOG00000001719 transcript:ENSGGOT00000033189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEINLPGPLSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAI
LLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTL
RDFTLELEVDGEPITADDYLEHSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPA
PKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRESLSLPTSYL
DFLLLPIVEDKMESIRQKESSRSSDERISKKTCLPKPDTRLVTSALHELLDLHRDSEREA
IEVFMKNSFKDVDQIFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDVKQ
GTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLSE
KEKAIEVERIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQFLE
EEEKTLALKLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLDPIC
Download sequence
Identical sequences ENSGGOP00000024506 ENSGGOP00000024506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]