SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024541 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024541
Domain Number 1 Region: 374-494
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-27
Family SH2 domain 0.00043
Further Details:      
 
Domain Number 2 Region: 497-535
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000109
Family SOCS box-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024541   Gene: ENSGGOG00000023191   Transcript: ENSGGOT00000029860
Sequence length 535
Comment pep:novel chromosome:gorGor3.1:18:68669284:68671818:1 gene:ENSGGOG00000023191 transcript:ENSGGOT00000029860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGED
EKSGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQS
ETTCQEQANSLKSSASHNGDLHLHLDEHMPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RAGHDDVPPLLPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences ENSGGOP00000024541 ENSGGOP00000024541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]