SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024842 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024842
Domain Number 1 Region: 157-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000263
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 190-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000942
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024842   Gene: ENSGGOG00000025900   Transcript: ENSGGOT00000023239
Sequence length 244
Comment pep:novel chromosome:gorGor3.1:9:51910953:51936409:-1 gene:ENSGGOG00000025900 transcript:ENSGGOT00000023239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA
PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC
LKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL
ANAL
Download sequence
Identical sequences A0A024R260 A0A2I2YB99 H2PSC7 H2RES0 Q13886
ENSPPYP00000021595 ENSP00000366330 ENSPTRP00000060008 gi|4557375|ref|NP_001197.1| NP_001197.1.87134 NP_001197.1.92137 XP_002819900.1.23681 XP_003806414.1.60992 XP_004048160.1.27298 XP_520067.2.37143 ENSP00000366330 ENSGGOP00000024842 ENSGGOP00000024842 ENSP00000366330 ENSPPYP00000021595 9598.ENSPTRP00000035914 9600.ENSPPYP00000021595 9606.ENSP00000366330 ENSPTRP00000060008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]