SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024905 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024905
Domain Number 1 Region: 270-339
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000019
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024905
Domain Number - Region: 57-80
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0246
Family CCCH zinc finger 0.0082
Further Details:      
 
Domain Number - Region: 93-110
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0392
Family CCCH zinc finger 0.0082
Further Details:      
 
Domain Number - Region: 181-242
Classification Level Classification E-value
Superfamily Ganglioside M2 (gm2) activator 0.0562
Family Ganglioside M2 (gm2) activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024905   Gene: ENSGGOG00000025144   Transcript: ENSGGOT00000026631
Sequence length 371
Comment pep:novel chromosome:gorGor3.1:12:86654231:86655387:-1 gene:ENSGGOG00000025144 transcript:ENSGGOT00000026631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEVPGPFLCGINSNGGGCSSQTNSHNSPTRIPTVTILSPGGRRGGRGSDGSGGSWTKQVT
CRYFMHGGYKEGDNCCKLHDLSDSPYNVVYKSLQRGYCIYGDCCRYEHSKPLKQKEATAT
ELTTKSSLAASSSLSWIVGPLVEMNTGEAESRNSNFVTVGAGSEGWVNAVEFVPGQPYCG
RTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYRENLCVYGDSCDMCGQ
VLHLMDAAQRSQHIKSCFEAHEKDRELSFAVQRSEEMVCESCMEMIYEKANPREHRFRIL
SNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYCVEEKEEKQKLILKYK
EAMSNKACRYF
Download sequence
Identical sequences ENSGGOP00000024905 ENSGGOP00000024905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]