SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025066 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025066
Domain Number 1 Region: 186-541
Classification Level Classification E-value
Superfamily DNase I-like 2.75e-37
Family Sphingomyelin phosphodiesterase-like 0.028
Further Details:      
 
Domain Number 2 Region: 44-177
Classification Level Classification E-value
Superfamily L domain-like 9.07e-20
Family Ngr ectodomain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025066   Gene: ENSGGOG00000023412   Transcript: ENSGGOT00000028034
Sequence length 556
Comment pep:novel chromosome:gorGor3.1:4:86428924:86490596:-1 gene:ENSGGOG00000023412 transcript:ENSGGOT00000028034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTA
LHLNDNYLSRIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLSRELLLNNNLLRVLPY
ELGRLFQLQTLGLKGNPLSQDILNLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKE
RDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQ
EVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHT
VEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANA
HMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGV
VEYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTN
YTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELH
PPLLPLVNGVHLPNRR
Download sequence
Identical sequences ENSGGOP00000025066 ENSGGOP00000025066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]