SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025088 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025088
Domain Number 1 Region: 379-645
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-77
Family Protein kinases, catalytic subunit 0.000000000265
Further Details:      
 
Domain Number 2 Region: 4-168
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-53
Family Pleckstrin-homology domain (PH domain) 0.0000000302
Further Details:      
 
Domain Number 3 Region: 276-418
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-31
Family SH2 domain 0.0000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025088   Gene: ENSGGOG00000022176   Transcript: ENSGGOT00000022818
Sequence length 656
Comment pep:novel chromosome:gorGor3.1:X:98642432:98667478:-1 gene:ENSGGOG00000022176 transcript:ENSGGOT00000022818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQDFLLNGKIEGSQQPCNPITCLEQNLIFLMSFFFFFFGSFLRSRK
PFLTYYSRTSLVPSWRGHHALKSRRITLKEKGVDNLMWYSKHMTRSQAEQLLKQEGKEGG
FIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQ
HNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRG
QYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLL
NYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLS
RYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTN
SETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Download sequence
Identical sequences ENSGGOP00000025088 ENSGGOP00000028572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]