SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025090 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025090
Domain Number 1 Region: 269-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-34
Family Pentraxin (pentaxin) 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025090   Gene: ENSGGOG00000005872   Transcript: ENSGGOT00000024562
Sequence length 478
Comment pep:novel chromosome:gorGor3.1:16:1576249:1580365:-1 gene:ENSGGOG00000005872 transcript:ENSGGOT00000024562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSWRKTLSFFLVFVPIYLHGASSQEAAPVGPRKLFFERLRRLEEQFRRFQEVTWTHLQ
SIASNYNVFYNIDVRFRSLAEESQAVAQAVNRSQASVQGELAQLKAWVRKLQCRSRKVDT
RLRALDLTLGERSQQRARERKAHKAQRDALQDSLARLEGLVHSQGARLAALEGRLPVAHP
GTAALGPALVPTPTQPEELGPTSLKLQRDRQELRAASEHGGPPQDSSAPLQGRREPPASG
SHRVLSGTAPKDPRQQAWSPQVPGEICGVGPTLVFPNASTKNVVFLGPGFVTALRALSFC
SWVRTASSRLGTLLSYATEDNDNKLMLHGRDSLLPGSIHFVIGDPAFRELPLQLLLDGQW
HHICVIWTSTQGRYWLHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDSVGGGFDSSEAF
VGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILMLANAALAGGFVQRANCTCLERCP
Download sequence
Identical sequences ENSGGOP00000025090 ENSGGOP00000025090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]