SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025696 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000025696
Domain Number - Region: 236-265
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000499
Family LIM domain 0.0037
Further Details:      
 
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00241
Family PDZ domain 0.033
Further Details:      
 
Domain Number - Region: 204-235
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00418
Family LIM domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025696   Gene: ENSGGOG00000024179   Transcript: ENSGGOT00000029623
Sequence length 281
Comment pep:novel chromosome:gorGor3.1:3:97822301:97823169:1 gene:ENSGGOG00000024179 transcript:ENSGGOT00000029623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CMKDVITAIDRENISNMMHLEAQKKKGCTMTLTIARSEYKIVMEKRKCHPYKMNLHSEPQ
EVPHVGSACNPSTMLFTASPASSTVPGVINQYSNPAGLSSSENISNFNNTLRYHIAGISK
TAASREEANGLPIDHVQPPSGLIINKESEVYKMLQEKQELNEPLKQSTSFLILQEILESE
IKGDLNPSGFRSVKTPDPKAASIGNAQKVPMCDKCGPGIVGMFVKLDHHPLPECYVCIDC
DTHPKEKGFFFFFPHQIYCEEHAQEQVTPLEGTMWSSCSPS
Download sequence
Identical sequences ENSGGOP00000025696 ENSGGOP00000025696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]