SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026158 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026158
Domain Number 1 Region: 184-598
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.23e-88
Family Amylase, catalytic domain 0.0000871
Further Details:      
 
Domain Number 2 Region: 600-697
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-25
Family alpha-Amylases, C-terminal beta-sheet domain 0.0069
Further Details:      
 
Domain Number 3 Region: 69-181
Classification Level Classification E-value
Superfamily E set domains 2e-19
Family E-set domains of sugar-utilizing enzymes 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026158   Gene: ENSGGOG00000026805   Transcript: ENSGGOT00000032873
Sequence length 702
Comment pep:novel chromosome:gorGor3.1:3:83576128:83851296:-1 gene:ENSGGOG00000026805 transcript:ENSGGOT00000032873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIG
ENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYG
KWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDP
EHSYEFKHSRPKKPRSLRIYESHVGISSYEGKVASYKHFTCNVLPRIKGLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVT
SMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESH
DQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAP
QAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYADYRVGTALPGKFKIVLDSDAAEYGGH
QRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
Download sequence
Identical sequences G3SDH8
XP_004035964.1.27298 ENSGGOP00000026158 ENSGGOP00000026158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]