SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026423 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026423
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.77e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000401
Further Details:      
 
Domain Number 2 Region: 183-308
Classification Level Classification E-value
Superfamily E set domains 2.29e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026423   Gene: ENSGGOG00000024826   Transcript: ENSGGOT00000030268
Sequence length 598
Comment pep:novel chromosome:gorGor3.1:2a:62007484:62048613:1 gene:ENSGGOG00000024826 transcript:ENSGGOT00000030268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAYNPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHPTLASQNAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVS
SQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTGTLPSNSQ
GIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNVLSNCSVNMMTT
SSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTAVFVSQSDA
FEGTDFSCADNSMINESGPSNSTNPNSHGFVQGSQYSGIGSMQNEQLSDSFPYEFFQV
Download sequence
Identical sequences ENSGGOP00000026423 ENSGGOP00000018627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]