SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026454 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026454
Domain Number 1 Region: 191-366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-64
Family SPRY domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000124
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026454   Gene: ENSGGOG00000021935   Transcript: ENSGGOT00000029668
Sequence length 394
Comment pep:novel chromosome:gorGor3.1:1:228514604:228536437:1 gene:ENSGGOG00000021935 transcript:ENSGGOT00000029668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRRCARHGEDLSRFCEEDQAALCWVCDAGPEHRTHHTAPLQEAAGSYQVKLQMALELVRK
ELEDALTQEANVGKRTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERATL
QRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPME
LKTACCIPGRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFDTW
PCILGLQSFSSGRHYWEVLVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEY
MVLASPSVPLLQLESPRCIGIFLDYEAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFICD
ATPLILPPTTVAGSGNWASRDHLDPASDVRDDHL
Download sequence
Identical sequences ENSGGOP00000026454 ENSGGOP00000026454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]