SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027161 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000027161
Domain Number - Region: 128-174
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0683
Family FHA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027161   Gene: ENSGGOG00000028099   Transcript: ENSGGOT00000032142
Sequence length 457
Comment pep:novel chromosome:gorGor3.1:1:167453115:167454676:1 gene:ENSGGOG00000028099 transcript:ENSGGOT00000032142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSSQTYSLAWKHSGDFKKLAWWVSVVQGKAWATSCSKPEEVKKERSVVLLYPDSWEPDV
QDSRGENLEEEQLHPPTAASFPSGDPSPYSLDTLKRRTILRPHRLKRMSHWLFEAPSSCS
MSGPERWYHQGLACFSDLNTHGTSLRKTGIPQCTYCWVHEGHALCLGDIYFILQGPEEDK
TESKTVAQLKELDKQQKMLEKMVEDLEEEMDASGRKINTSKNDEMGCPRMREDIVKAEAE
ENFTVEFSEKREVFYINNQTNLPHHFFNQGDSSGKQRQAEAIHLGEKKETKIQWSAEACS
FLCTVRFPLHQEAVYQKKKVRNWEDEDFYESDDDIFFHSADLVEKCLNQIIKAGKIDEKA
ETFALLLSESQSQASLDVFMSEVKDSSLNGMSQKKFRFELMKLRLKGLIKIVKPAETSEL
NMIENTKDTDKATKLILTLLGAIKAGSKLKLKTGTVK
Download sequence
Identical sequences ENSGGOP00000027161 ENSGGOP00000027161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]