SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027487 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027487
Domain Number 1 Region: 64-256
Classification Level Classification E-value
Superfamily Sec7 domain 9.03e-77
Family Sec7 domain 0.0000000466
Further Details:      
 
Domain Number 2 Region: 264-385
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-33
Family Pleckstrin-homology domain (PH domain) 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027487   Gene: ENSGGOG00000008228   Transcript: ENSGGOT00000027949
Sequence length 399
Comment pep:novel chromosome:gorGor3.1:22:21598682:21632307:1 gene:ENSGGOG00000008228 transcript:ENSGGOT00000027949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RREGGPAEVRAKPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEE
SRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDIQDIARFLYKGEGLNKTAIGTYL
GERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCN
PGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLF
DSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTT
DKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRI
SATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
Download sequence
Identical sequences ENSGGOP00000027487 ENSGGOP00000008045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]