SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027541 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027541
Domain Number 1 Region: 341-509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-57
Family SPRY domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 20-107
Classification Level Classification E-value
Superfamily RING/U-box 1.25e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 128-186
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.31e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027541   Gene: ENSGGOG00000022070   Transcript: ENSGGOT00000028450
Sequence length 512
Comment pep:novel chromosome:gorGor3.1:5:165746787:165760308:-1 gene:ENSGGOG00000022070 transcript:ENSGGOT00000028450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAYLSPRTTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRCWER
PGAGSVGAATRAPPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPGEHGSQ
AAAARAAAARCGQHGEPFKLYCQDDGRAICVVCDRAREHREHAVLPLDEAVQEAKELLES
RLRVLKKELEDCEVFRSTEEKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLE
ELSREVAQKQNENLAQLGAEITQLSKLRSQIQETAQKPDLDFLQEFKSTLSRCSNEPGPK
PTTVSSEMKNKVWNVSLKTFVLKGMLKKFKEDLRGELEKEEKVELTLDPDTANPRLILSL
DLKSVRLGERAQDLPNHPCRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVR
RKGLTPFTPEEGVWALQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVED
MRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences ENSGGOP00000027541 ENSGGOP00000027541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]