SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028229 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028229
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-39
Family Dual specificity phosphatase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028229   Gene: ENSGGOG00000004744   Transcript: ENSGGOT00000029803
Sequence length 198
Comment pep:novel chromosome:gorGor3.1:6:179714:227316:1 gene:ENSGGOG00000004744 transcript:ENSGGOT00000029803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHF
KESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANP
NVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILGKYKEQGRTEPQPGARRW
SSFPALAPLTYDNYTTET
Download sequence
Identical sequences ENSGGOP00000028229 ENSGGOP00000004649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]