SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028262 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028262
Domain Number 1 Region: 336-594
Classification Level Classification E-value
Superfamily Kelch motif 6.93e-40
Family Kelch motif 0.00088
Further Details:      
 
Domain Number 2 Region: 42-166
Classification Level Classification E-value
Superfamily POZ domain 1.49e-32
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028262   Gene: ENSGGOG00000028568   Transcript: ENSGGOT00000022566
Sequence length 675
Comment pep:novel chromosome:gorGor3.1:13:23248060:23250114:-1 gene:ENSGGOG00000028568 transcript:ENSGGOT00000022566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSREDVPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFA
DAFDHHKLRSQAQSYIAQNFKQLSRMGSIREETLADLTLAQLLAVLRLDSLDIESERTVC
HVAVQWLEAAAKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQ
MRYGDLLYKSLVPVPNSLVSAAENPPQRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTM
PSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMD
VAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAV
NSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISN
IPLDSETHNYQIVNHDQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDS
GFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDDEVWV
QVAPQRNAQDQQGSL
Download sequence
Identical sequences ENSGGOP00000028262 ENSGGOP00000028262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]