SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028739 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028739
Domain Number 1 Region: 115-355
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.04e-59
Family G proteins 0.00000225
Further Details:      
 
Domain Number 2 Region: 431-536
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.91e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00032
Further Details:      
 
Domain Number 3 Region: 332-425
Classification Level Classification E-value
Superfamily Translation proteins 1.3e-24
Family Elongation factors 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028739   Gene: ENSGGOG00000034956   Transcript: ENSGGOT00000040980
Sequence length 537
Comment pep:novel chromosome:gorGor3.1:6:135655471:135698993:-1 gene:ENSGGOG00000034956 transcript:ENSGGOT00000040980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKPVDSQTSQSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAI
ASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLNL
VVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEERERG
VTMDVGMTKFETTTKIITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETG
GQTREHGLLVRSLGVTQLAVAVNKMDQVFKGFVEICLRLSFISQSFLIESDVAFIPTSGL
SGENLITRSQSSELTKWYKGLCLLEQIDSFKPPQRSIDKPFRLCVSDVFKDQGSGFCITG
KIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCI
FCGPKVPIKACTRFRARILIFNIEIPITKGFPVLLHYQTVSEPAVIKRLISVLNKSTGEV
TKKKPKFLTKGQNALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEIKE
Download sequence
Identical sequences ENSGGOP00000028739 ENSGGOP00000028739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]