SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336325394|ref|YP_004605360.1| from Corynebacterium resistens DSM 45100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336325394|ref|YP_004605360.1|
Domain Number 1 Region: 14-258
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.73e-77
Family Tryptophan biosynthesis enzymes 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336325394|ref|YP_004605360.1|
Sequence length 268
Comment Indole-3-glycerol phosphate synthase [Corynebacterium resistens DSM 45100]
Sequence
MPTVLDQIIAGVLEDQAAREAKVPYAEIKAKSLDAPAPIDAFAALSGHSVKVIAEVKRAS
PSKGHLADISEPEVLAKAYADNGATVISCLTEERRFKGSLSDFDAVRRAVDIPLLRKDFI
VNPYQIHEARAHGADMVLLIVAALEQDRLTALLDRTESLGMTALVEVHTEEEAERAVAAG
AKVIGVNARNLKTLEVDMDVFGRIAPALPSSVIKVAESGVKDKHDLLAYAGAGADAVLVG
EGLVTAGIPGQACKKLVVAGQHPSCPQP
Download sequence
Identical sequences F8E0F5
WP_013888213.1.72862 gi|336325394|ref|YP_004605360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]