SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000000870 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000000870
Domain Number 1 Region: 230-474
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-71
Family Nuclear receptor ligand-binding domain 0.000000000276
Further Details:      
 
Domain Number 2 Region: 120-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-28
Family Nuclear receptor 0.00000402
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000000870
Domain Number - Region: 18-86
Classification Level Classification E-value
Superfamily CAC2185-like 0.0445
Family CAC2185-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000000870   Gene: ENSCHOG00000000987   Transcript: ENSCHOT00000000989
Sequence length 476
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_4684:8138:47889:-1 gene:ENSCHOG00000000987 transcript:ENSCHOT00000000989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYCMQETHEVHSAAGSNCYMQSTDYYAYFEDIPGYSACDAQALPSNNIYMEQAWAVNQP
YTCNYPGNMFKSKDSDLDMALNQYSQPEYFTEEKPTFSQVQSPSYSQKKGYIPSYLDKDE
LCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECR
FKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTV
TEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVD
FAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGG
LGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEH
YINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences ENSCHOP00000000870 ENSCHOP00000000870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]