SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000001712 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000001712
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.65e-58
Family Rhodopsin-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000001712   Gene: ENSCHOG00000001947   Transcript: ENSCHOT00000001951
Sequence length 234
Comment pep:novel scaffold:choHof1:scaffold_271633:5:709:1 gene:ENSCHOG00000001947 transcript:ENSCHOT00000001951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLYNLSGRDKTISYTGCAIQLFLFLGLGGVECLLLAVMAYDRFVAVCKPLHYMVIMNPRL
CLGLVSVAWGCGVANSLAMSPVTLHLPRCGRRCVDHFLCEMPALIRMACVNTVAIEGTVF
VLAVGIVLSPLVFILVSYGYIVRAVLQIQSASGRQKIFNICGSHLTVVSLFYGNIIYMYM
QPGNSSSQDQGKFLTLFYNIVTPLLNPLIYSLRNKEMKGALRRLLLGNQGAEKE
Download sequence
Identical sequences ENSCHOP00000001712 ENSCHOP00000001712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]