SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000002403 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000002403
Domain Number 1 Region: 178-191,317-578
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.53e-43
Family Nuclear receptor ligand-binding domain 0.00065
Further Details:      
 
Domain Number 2 Region: 108-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000002403   Gene: ENSCHOG00000002709   Transcript: ENSCHOT00000002724
Sequence length 590
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6719:542:33063:1 gene:ENSCHOG00000002709 transcript:ENSCHOT00000002724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSWASGPQCLFTPLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVIL
ASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKADVQRPQVVEYCVVCGDKASG
RHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMES
VQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLV
NIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSA
SEITRAFDTLAKALNTTDSCSPPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTH
VTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNEL
FTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLD
IDGYEYAYLKAIVLFSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARILVR
LPALRLMSSNITEELFFTGLIGSVSIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences ENSCHOP00000002403 ENSCHOP00000002403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]