SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003826 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003826
Domain Number 1 Region: 546-645
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.88e-16
Family Nuclear receptor ligand-binding domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 317-357
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000316
Family Nuclear receptor 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003826   Gene: ENSCHOG00000004326   Transcript: ENSCHOT00000004339
Sequence length 647
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6135:12:29432:1 gene:ENSCHOG00000004326 transcript:ENSCHOT00000004339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFLRGDCMYAPLLGGPPAVRPTPCAPLAECKGSLLDEGPGKDTEESADYSPFKGGYAKGP
DGETLGCSGSGEAGGSGTLELPSTLSLYKSGALDEATAYQSRDYYNFPLALAGPPPPPPP
PHPHTRIKLENPLDYGSAWEAAAAQCRYGDLASPHGGGAAGPGSGSPSAAASSSWHTLFT
AEESQLYGPCGGGSGGNAGGEAGAVAPYGYTRPPQGLAGQEGDFAPPDVWYPGGVVSRVP
YPSPSCVKSEMGPWMESYSGPYGDMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXNSRVLYFAPDPVFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPVDGLKSQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKFLDSVQPIARE
LHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences ENSCHOP00000003826 ENSCHOP00000003826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]