SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000004454 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000004454
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000875
Family EGF-type module 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000004454   Gene: ENSCHOG00000005029   Transcript: ENSCHOT00000005047
Sequence length 178
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6571:6767:30965:-1 gene:ENSCHOG00000005029 transcript:ENSCHOT00000005047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAAPGSSASSLSLLLALVLGLVILHCVVADGNSTRRPETEGFLCGDPGENCAATTTQS
KRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFYLRGDRGHIL
VICLIAVMVIFIILVVGICTCCHPLRKHHKRKKKEEEMETLDKDLIPINEDIQETNIA
Download sequence
Identical sequences ENSCHOP00000004454 ENSCHOP00000004454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]