SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000005281 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000005281
Domain Number 1 Region: 22-252
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-70
Family Nuclear receptor ligand-binding domain 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000005281   Gene: ENSCHOG00000005980   Transcript: ENSCHOT00000005990
Sequence length 268
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6641:5300:10972:1 gene:ENSCHOG00000005980 transcript:ENSCHOT00000005990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMG
IENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAP
LLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGL
SDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVG
KTPIETLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences ENSCHOP00000005281 ENSGGOP00000011182 ENSCHOP00000005281 ENSTTRP00000001434 ENSTTRP00000001434 ENSGGOP00000011182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]