SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006291 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006291
Domain Number 1 Region: 627-637,672-792,829-916
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.15e-38
Family Nuclear receptor ligand-binding domain 0.0000000358
Further Details:      
 
Domain Number 2 Region: 563-641
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006291   Gene: ENSCHOG00000007092   Transcript: ENSCHOT00000007116
Sequence length 931
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_900:325:27546:-1 gene:ENSCHOG00000007092 transcript:ENSCHOT00000007116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLKAKDPRAPHVEGGPPSPTQVGPPGLGHPDTGPFXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXPILPFNSAFLAARTRQLLEGESYEVGAGAAATSAFIPPRGSPSVLSAPVTGGD
FPDCAYPPDAEPKDDAFPLYGDFQPLALKIKEEEEGAEAAARSSRPYLLAGANPTVFPDF
PLALPSRASSSRPGEAAAATRKEDFTISGTSLSSGSTLECILYKAEGAQPQQGPFAPPPC
KASSASACLLSRDGLPSTSASSAPSTAPALYQPLGLNGLPQLGYQAAVLKEGLPQVYPPY
LNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNY
LCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLDAVALPQPVG
IPNESQALSQRIPFSPSQEIQFIPSLINLLMSIEPDISYAGHDNTKDTSSSLLTSLNQLG
ERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDL
ILNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLEGLRSQNQFE
EMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALC
VEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences ENSCHOP00000006291 ENSCHOP00000006291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]