SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006507 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006507
Domain Number 1 Region: 171-374
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-39
Family Nuclear receptor ligand-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-24
Family Nuclear receptor 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006507   Gene: ENSCHOG00000007344   Transcript: ENSCHOT00000007365
Sequence length 377
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_2076:2878:14846:1 gene:ENSCHOG00000007344 transcript:ENSCHOT00000007365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQ
CRACRLKKCLEVNMNKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPHEVNGTPMYLYEVATESVCESA
ARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMN
GDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFR
NAAAIAALQDEAQLTLNSYIHTXXXXXXXXXXXXXXXSPALRFISPSTPRKEGFFQKKTI
GNVPITRLFSDMFQPSD
Download sequence
Identical sequences ENSCHOP00000006507 ENSCHOP00000006507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]