SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007423 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007423
Domain Number 1 Region: 129-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-52
Family Nuclear receptor ligand-binding domain 0.000000234
Further Details:      
 
Domain Number 2 Region: 55-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-30
Family Nuclear receptor 0.00000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007423   Gene: ENSCHOG00000008398   Transcript: ENSCHOT00000008415
Sequence length 387
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_2593:3:28454:1 gene:ENSCHOG00000008398 transcript:ENSCHOT00000008415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLAMGAHNNSLNSPPMFAGAALGGTACRKSYEDCAGGLMEDSAIKCEYMLNAIPKRLCLV
CGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLK
VGMLKEGVRLDRVRGGRQKYKRRLDSESSTYLSLQISPPAKKPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGWAKHIPGFSNLSLGDQMSLLQSAWMEILI
LGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLK
ALALANSXXXXXXXXXXXXXXXDLLHEALQDYELSQRHEEPRRTGKLLLTLPLLRQTAAK
AVQHFYSVKLQGKVPMHKLFLEMLEAK
Download sequence
Identical sequences ENSCHOP00000007423 ENSCHOP00000007423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]