SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007529 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007529
Domain Number 1 Region: 21-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-25
Family Nuclear receptor 0.0000207
Further Details:      
 
Domain Number 2 Region: 176-250
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000102
Family Nuclear receptor ligand-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007529   Gene: ENSCHOG00000008514   Transcript: ENSCHOT00000008533
Sequence length 250
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_1985:6490:23570:-1 gene:ENSCHOG00000008514 transcript:ENSCHOT00000008533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMAASTSLPDSGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPVRGNEDEGNHLSRPFSQHTPSFSG
DSSSSSGHYTTSSDLMETAGFSNLDLNEDDSDDTSVTLDLSQLSMLPHLADLVSYSIQKV
IGFAKMIPGF
Download sequence
Identical sequences ENSCHOP00000007529 ENSCHOP00000007529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]