SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007780 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007780
Domain Number 1 Region: 206-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-76
Family Nuclear receptor ligand-binding domain 0.00000000143
Further Details:      
 
Domain Number 2 Region: 71-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000887
Family Nuclear receptor 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007780   Gene: ENSCHOG00000008796   Transcript: ENSCHOT00000008814
Sequence length 437
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_2039:2819:17135:1 gene:ENSCHOG00000008796 transcript:ENSCHOT00000008814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGSPQLNGGPEHLLPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFGNLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFGDIIEPKFEFAVKFNALELDDSDLALFVAAIILCGD
RPGLMNVSQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KNTETETSLPPLYKDMY
Download sequence
Identical sequences ENSCHOP00000007780 ENSCHOP00000007780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]