SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008839 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008839
Domain Number 1 Region: 168-444
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.17e-77
Family Nuclear receptor ligand-binding domain 0.00000000164
Further Details:      
 
Domain Number 2 Region: 126-195
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.67e-24
Family Nuclear receptor 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008839   Gene: ENSCHOG00000009975   Transcript: ENSCHOT00000010006
Sequence length 450
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_7784:1423:9660:-1 gene:ENSCHOG00000009975 transcript:ENSCHOT00000010006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSPDSSSPNPLHQGGPSPGPPLPPSAAPPLGGSGGPPPLPPPQLGSPFPVISSSMGSPG
LPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPDVKPPVLGSGLHCPPPPGPGAGKRLXXX
XXXXXXXKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLA
TGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGG
SGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHR
SIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRA
IILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKC
LEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences ENSCHOP00000008839 ENSCHOP00000008839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]