SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011513 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011513
Domain Number 1 Region: 276-461
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-48
Family Nuclear receptor ligand-binding domain 0.0000000489
Further Details:      
 
Domain Number 2 Region: 141-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.62e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011513   Gene: ENSCHOG00000012987   Transcript: ENSCHOT00000013031
Sequence length 462
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_413:260726:293702:-1 gene:ENSCHOG00000012987 transcript:ENSCHOT00000013031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKNSPSGLNSAASYNCSQSVLPLEHGPIYIPSSFVESRHEYSAMTFYSPAVMNYSIPC
SANNSEGGPGGQTKSPNVLWPSPGHLSPLALHCPSSLLYAEPQKSPWCEARSLEHSLPIN
RRKVSGSSCASPVTSQKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICP
ATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNVSITESSMMMSLTKLADKEL
VHMIGWAKKIPGFVELSLYDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDE
GKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLAAATQEAESSRKL
SHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHVRHA
Download sequence
Identical sequences ENSCHOP00000011513 ENSCHOP00000011513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]