SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011693 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011693
Domain Number 1 Region: 1-296
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.47e-76
Family Rhodopsin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011693   Gene: ENSCHOG00000013213   Transcript: ENSCHOT00000013242
Sequence length 296
Comment pep:novel scaffold:choHof1:scaffold_46003:7732:8619:-1 gene:ENSCHOG00000013213 transcript:ENSCHOT00000013242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSNHSTIMEFILLGLSADPHVQVLLFVLFLVIYLLTLMGNLLMLLVIRADSHLHTPMY
FFLSQLSFVDLCFSSVILPKMLENLLSKMKAISVEGCLAQIFFVLVTGGTEASLLTMMAY
DRYAAICHPLLYAQVMSNQLCVRLVLVSWVLGILDMLLNVPLAVKMDFCGTCIIPHYSCE
LPSLFLLSCSDVSINLIVMFCSIIPHGLATFLSIFYSYGCIVSTILSISSSSGRSKAFST
CSSHLITVSLFYGSAFLRYLTPTSGSPLELIFSLQYNVITPMLNPLIYSLKNKEVK
Download sequence
Identical sequences ENSCHOP00000011693 ENSCHOP00000011693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]