SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011700 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011700
Domain Number 1 Region: 369-483
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.02e-37
Family Nuclear receptor ligand-binding domain 0.000000407
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-27
Family Nuclear receptor 0.0000664
Further Details:      
 
Domain Number 3 Region: 192-200,257-318
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000236
Family Nuclear receptor ligand-binding domain 0.0000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011700   Gene: ENSCHOG00000013215   Transcript: ENSCHOT00000013250
Sequence length 484
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_164:13192:50866:1 gene:ENSCHOG00000013215 transcript:ENSCHOT00000013250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQGLENPIQISPHHSHTSSGFVMEMLSPKPAKGVLTEPAAGPLGQNLEVEPYTQYS
NVQFPQVQPQISSSSYYSNLGFYAQQPEEWCPPGMYELRRMPAESLYPGETEGAEIPVPK
KARMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHIDQTINEDSEG
RDLRQVTSTTKSCREKTELTPDQQNLLHYIMDAYSKQRMPQEITNKIREFSAEENFLILT
EMATSHVQILVEFTKRLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQ
EPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRANDHKFTPLLCEI
WDVQ
Download sequence
Identical sequences ENSCHOP00000011700 ENSCHOP00000011700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]