SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000000831 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000000831
Domain Number 1 Region: 116-362
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.15e-63
Family Nuclear receptor ligand-binding domain 0.00000000197
Further Details:      
 
Domain Number 2 Region: 48-130
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000000831   Gene: ENSCHOG00000000938   Transcript: ENSCHOT00000000942
Sequence length 445
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_1462:5203:27216:1 gene:ENSCHOG00000000938 transcript:ENSCHOT00000000942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMANYSEVLDPTYTTLEFETMQILYNSNDSSAPETTSMNTADNGVNCLCAICGDRATGK
HYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAV
QNERDRISTRRSTFDGSNIPSINTLAQAEALSRQIPVSSPGASTDINVKKIASIADVCES
MKQQLLVLVEWAKYIPAFCELPLDDVALLRAHAGEHLLLGATKRSMVYKDILLLGNNYVI
HRNSCEVEISRVANRILDELVRPFQDIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMR
FQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDSLLQE
MLLGGASNDAGHLHHPMHPHLSQDPLTGQTILISSMSTLVHTDQISTPETPLPSPPQGSG
QEHYKITANQASVISHQSLAKQKQL
Download sequence
Identical sequences ENSCHOP00000000831 ENSCHOP00000000831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]