SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000002647 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000002647
Domain Number 1 Region: 576-621
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000485
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 2 Region: 658-698
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000222
Family Ovomucoid domain III-like 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000002647
Domain Number - Region: 697-721
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000166
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000002647   Gene: ENSCHOG00000002985   Transcript: ENSCHOT00000003003
Sequence length 915
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_2777:3947:54469:1 gene:ENSCHOG00000002985 transcript:ENSCHOT00000003003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFSSKSESRLKHLLQRAPDYCPETMVDIWSCMNSSLPGVFKKSDGWVGLGCCELAIASEC
RQTCKQASSKNDISKVCRKEYENALFSCINRNEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMPTDSLYCCDRAEDHACQIACKRILMS
KKTDTEIVDGLIEGCKTQPLPQDPLWQCFLESSRSVHPGVTVHPPPSTGLDGAKLHCCSK
ANTSTCRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTY
CTNFNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLENCIPLD
TYLRPSALGNIVEEVTHPCNPNPCPANELCEVNRKGCLSGDPCLPYSCVQGCKLGEASDF
IVRQGTLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPCNCADQFVPVCGQNGRTYPSACI
ARCVGLQDHQFEFGSCISKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLT
CDQVRDPVCDTDHMEHNNLCTLYQRGKSLSYNGPCQPFCSLKPVCGHNGETYSSMCAAYX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCKPIIPRGACCPLCAGMLRVLF
DKEKLDTIAKVTNKKPIAVLEILQKIRMHVSVPQCDVFGYLSIESEIVILIIPVDHSPKA
LQVEACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSASVRARSPCHSCLF
LLSLGPALHCLWTHN
Download sequence
Identical sequences ENSCHOP00000002647 ENSCHOP00000002647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]