SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003404 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003404
Domain Number 1 Region: 4-230
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-62
Family Nuclear receptor ligand-binding domain 0.00000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003404   Gene: ENSCHOG00000003854   Transcript: ENSCHOT00000003867
Sequence length 232
Comment pep:known_by_projection scaffold:choHof1:scaffold_129503:426:1555:-1 gene:ENSCHOG00000003854 transcript:ENSCHOT00000003867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATVNALVSHLLVVEHEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSS
LSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQ
LVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAGPGG
GDERRRTGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAMMD
Download sequence
Identical sequences ENSCHOP00000003404 ENSCHOP00000003404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]