SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003768 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003768
Domain Number 1 Region: 34-145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-29
Family SPRY domain 0.00000419
Further Details:      
 
Domain Number 2 Region: 233-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000222
Family SOCS box-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003768   Gene: ENSCHOG00000004260   Transcript: ENSCHOT00000004272
Sequence length 273
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6588:5302:34874:1 gene:ENSCHOG00000004260 transcript:ENSCHOT00000004272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSGSLKSVEVREPALRPAKREVQGTESGRPARLDQLLDMPVASLAVQLQHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATV
RAPLHSVGYSALVGSDAESWGWDLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPLPLMDL
CRRSIRSALGRQRLRDISCLPLPQSLKNYLQYQ
Download sequence
Identical sequences ENSCHOP00000003768 ENSCHOP00000003768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]