SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000004895 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000004895
Domain Number 1 Region: 1221-1349
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.75e-31
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1078-1141
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.52e-17
Family Complement components 0.0039
Further Details:      
 
Domain Number 3 Region: 743-795
Classification Level Classification E-value
Superfamily E set domains 0.000000882
Family SVA-like 0.072
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000004895
Domain Number - Region: 901-926
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000404
Family Complement components 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000004895   Gene: ENSCHOG00000005507   Transcript: ENSCHOT00000005545
Sequence length 1387
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_5079:7915:101332:1 gene:ENSCHOG00000005507 transcript:ENSCHOT00000005545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTPALLPAAHLLCVWTAALAAAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSFRTLILPSLPLNSVDEIYELRVTGRAQDEILFSNST
RLSFETKRLSVFIQTDKPLYKPKQDVKFRVVTLFSDFKPYKTSLSILIKDPKSNLIQQWL
SEQNDLGVVSKTFQLSSHPILGDWSIQVQVTXXXXXXXXXXXXXXLPKFEVVLQTPLYCS
LNSKSLNGTVTAKYTYGKPVKGDVTLIFLPLSFWGVEKNITKTFKINGSAHFSFNDEEMK
KVMDFSADLSEHMETSSLGPVEILAIVTESLTXXXXXXXXXXXXXQQHDYIIEFFDYATV
LKPSLNFTATVKLTRSDGNQLSPEERRNNVVITVTQKNYTNYWSTWRSQNKEMEDVQIIN
YTVPQNGIFKIEFPILNGSSELQLKAYFLDSVSNMAVHGMFVSPSKTYIKLKTKNENIKV
GSPFELVVTGNKQLKELSYMVVSKGQLVAVGKQNSATFSLTPENSWAPKACIIVYYVEDD
GEIINDVLKIPVQLVFKNEIKLFWSKAVAEPSEKVSLRISVTQPESRVGIVAIDKSVNLM
NASNDITMENVVHEELYNTGYYLGMFVNSFAVFQXXXXXXXXXXXXXXXXXXXXXDNAEI
AERFVEENGGPIVYESYDFSSVSNPRVRKHFPETWIWLDTNMGSRIYQDFEVTVPDSITS
WVATAFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEVTILNYLKLATE
VNITIGKSNKFDILMASNEINATGYQQTVLVRSEDGATVLFPIKPTHLGEIPITVTAISP
TASDAVTQKILVKAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XQGYQRELLYQREDGSFSAFGNYDPSGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQFWVSSVSKLSESWQP
SSLDIEVAAYALLSHFLQFRVSEGIPIMRWLSRQRNSLGGFASTQDTIVALKALSEFAAL
TNTERTNIQVTAVGPNSSPVKFLIDTQNRFLLQMAELTVEQPIAVNISASGFGFAICQLN
VIYNVKNSGSSRRRRSLQNEEAFDLDVAVKDNKDDVNHLNLNVCTRFLGPARSGMVLMEV
NMLSGFTVPPDAISQSEVIKNVEHDHGKINLYLDSVNETQFCVDIPAVRNFKVSNTQDAL
VSIVDYYEPRRQAVRSYNSHAKLASCDLCRDVAGCHTCGDGASGSLCQSSVIFIFCFPLL
FSLQCWL
Download sequence
Identical sequences ENSCHOP00000004895 ENSCHOP00000004895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]