SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007226 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007226
Domain Number 1 Region: 26-233
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-56
Family Nuclear receptor ligand-binding domain 0.0000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007226   Gene: ENSCHOG00000008181   Transcript: ENSCHOT00000008195
Sequence length 234
Comment pep:known_by_projection scaffold:choHof1:scaffold_157223:3019:4398:-1 gene:ENSCHOG00000008181 transcript:ENSCHOT00000008195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSAEALALRRAKQAQRRAEQASKQLSQEQKELIQTFLRAHTRHVGTMFDQFVQFGPPAH
LFIHHQPMPTLAPVLPLLTHFADINTFMVQQVIKFTKDLPLFRSLPMEDQISLLKGAAVE
ICHIALNTTFCLQTQNFRCGPLRYTMEDGAHVSPTAGFQVEFLELLFHFHGTLRRLQLQE
PEYVLMAAMALFSPALHPADRPGITQREEIDQLQEEMALTLHNYIRGQQPRPRD
Download sequence
Identical sequences ENSCHOP00000007226 ENSCHOP00000007226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]