SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007424 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007424
Domain Number 1 Region: 260-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-45
Family Nuclear receptor ligand-binding domain 0.0000000753
Further Details:      
 
Domain Number 2 Region: 76-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-16
Family Nuclear receptor 0.0000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007424   Gene: ENSCHOG00000008395   Transcript: ENSCHOT00000008414
Sequence length 452
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_779:21485:102634:1 gene:ENSCHOG00000008395 transcript:ENSCHOT00000008414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMDVLSVSPGQILFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSS
EELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDN
CVIKVTRNRCQYCXXXXXXXXXXXXXXVRNDRNKKKKEPSKQECTESYEMTAELDDLTEK
IRKAHQETFPSLCQLGKYTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVF
TFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSK
PHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGN
TAEHSPSISPSSVTAVSVSHHWCNKTISGYFK
Download sequence
Identical sequences ENSCHOP00000007424 ENSCHOP00000007424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]